PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009766294.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 288aa    MW: 31815.6 Da    PI: 9.7488
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009766294.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK64.41.8e-202673350
          RWP-RK  3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50
                    k+is++++sk F+lp+ dAA +Lgvc++vLK+iC ++G+ RWP+Rk+ 
  XP_009766294.1 26 KSISFDQVSKLFNLPLSDAAESLGVCASVLKKICYENGLVRWPYRKVI 73
                    79********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.4481094IPR003035RWP-RK domain
PfamPF020423.2E-182872IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MSNLQGSGPI SNPIQNPTPN PSTDPKSISF DQVSKLFNLP LSDAAESLGV CASVLKKICY  60
ENGLVRWPYR KVISGKSIED IKKEASREKQ ERSVEFPKAA GEKHDSLASS AISSFPGSPL  120
QNKSISSTVE MLKAGAFSQQ QGTRIAQSGS LLHFRVSNLT RGTSVNYDEF KYGFPSDGLS  180
TVTYRWWGNK SPDNNEDSRP NDDNAKNSKE QAENVAEKSE CKTSVDSMEA SSLTDVRKRA  240
VKEGKEMLRL GVYRGHRANM LDSTKRKILR QVFKSYFRVD GGMSNLES
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766294.10.0PREDICTED: protein NLP2
RefseqXP_016432827.10.0PREDICTED: protein NLP2-like
TrEMBLA0A0V0HW321e-155A0A0V0HW32_SOLCH; Uncharacterized protein
STRINGPGSC0003DMT4000202961e-153(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA107441921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.11e-10NIN like protein 7